PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009627320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 274aa    MW: 31288.8 Da    PI: 6.0468
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009627320.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding231.8e-072165446
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     WT+eE +l+  a++ +  +   +W  +a +++ g++  ++   +q 
   XP_009627320.1 21 WTKEENKLFESAIAIYDENtpnRWFQVADMIP-GKSVLDVMKQYQE 65
                     ******************9*************.*******999996 PP

2Myb_DNA-binding44.24.4e-14117161347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+++m   Rt+ q+ s+ qky
   XP_009627320.1 117 PWTEEEHRRFLMGLDKYGKGDWRNISKKMVISRTPTQVASHAQKY 161
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.3451671IPR017884SANT domain
SMARTSM007173.8E-91769IPR001005SANT/Myb domain
SuperFamilySSF466893.11E-111973IPR009057Homeodomain-like
PfamPF002496.1E-62165IPR001005SANT/Myb domain
CDDcd001671.12E-72166No hitNo description
Gene3DG3DSA:1.10.10.601.3E-12108166IPR009057Homeodomain-like
PROSITE profilePS5129421.106110166IPR017930Myb domain
SuperFamilySSF466892.35E-16111165IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-18113165IPR006447Myb domain, plants
SMARTSM007174.7E-12114164IPR001005SANT/Myb domain
PfamPF002492.0E-12117161IPR001005SANT/Myb domain
CDDcd001677.54E-10117161No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
METIFPISSS WMMQQNKSSI WTKEENKLFE SAIAIYDENT PNRWFQVADM IPGKSVLDVM  60
KQYQELAADV CDIEAGLVPN PGYFASSVTL ELVDDCGLQT FRKRGRSSDQ ERKKGVPWTE  120
EEHRRFLMGL DKYGKGDWRN ISKKMVISRT PTQVASHAQK YYQRQLSGCK DKRRPSIHDI  180
TTFHFVADTS GNNINSLSKE KFYSTPLQKF TTTTDVVNYW NSSSDEDLMD FGSSYGSSVV  240
AYPSEITSQS WDGHGANGNS QLQIQSTRYE IWDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1321831173RADIALIS
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101113RKRGRSSDQERKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00347DAPTransfer from AT3G11280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009627320.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016491072.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-79DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM1BUZ61e-143M1BUZ6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000534331e-142(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.22e-82MYB family protein